

| Catalog No. | YP396033 | ||||||
|---|---|---|---|---|---|---|---|
| Description |
Anti-Twin-Strep-tag Antibody (SAA0348) [SAA0348] (YP396033) is a mouse monoclonal antibody detecting Twin-Strep-tag in ELISA, WB. Suitable for General.
|
||||||
| Species reactivity | General | ||||||
| Applications | ELISA, WB | ||||||
| Host species | Mouse | ||||||
| Isotype | IgG2b | ||||||
| Clone ID | SAA0348 | ||||||
| Clonality | Monoclonal | ||||||
| Target | Twin-Strep-tag, Twin Strep tag, TwinStrep tag, Streptag, Strep tag, SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK | ||||||
| Purification | Protein A/G purified from cell culture supernatant. | ||||||
| Form | Liquid | ||||||
| Storage buffer | 0.01M PBS, pH 7.4. Please refer to the specific buffer information in the hardcopy of datasheet or the lot-specific COA. |
||||||
| Product Usage Information |
| ||||||
| Stability and Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Store at 4°C short term (1-2 weeks). Store at -20°C 12 months. Store at -80°C long term. | ||||||
| Note | For research use only. |

SDS-PAGE for Anti-Twin-Strep-tag Antibody (SAA0348).
Contact us for custom quotes, bulk requests and any other issues.
Mail: support@abinScience.com


+86-27-65523339
Building C, No. 666, Shen Dun Si Lu, Wuhan, 430206, China
中文
English
한국어
日本語
Español
Français
Русский