Please ensure Javascript is enabled for purposes of website accessibility
Home > Products > Antibodies > Research Grade Biosimilars

Anti-Human Coagulation Factor III/Tissue Factor Reference Antibody (Mevegtatug, RUO) (HB058086)

Price(USD):
Spec:
  • 100ug
  • 1mg
Number:
Get quote
  • Overview

  • Images

  • References

  • Datasheet

  • SDS

Overview
Catalog No.HB058086
Species reactivityHuman
ApplicationsELISA, FACS, Functional assay
Host speciesHuman
IsotypeIgG1, kappa
Clonality Monoclonal
Target RecName: Full=Tissue factor; Short=TF; AltName: Full=Coagulation factor III; AltName: Full=Thromboplastin; AltName: CD_antigen=CD142; Flags: Precursor, F3, TF; Coagulation factor III; Thromboplastin, Tissue factor; pfam01108, Tissue factor. /id=PRO_0000033638., Extracellular. /evidence=ECO:0000255., T -> A (in dbSNP:rs3917604). /evidence=ECO:0000269|Ref.9. /id=VAR_014298., /evidence=ECO:0007829|PDB:6R2W., WKS motif., /evidence=ECO:0007829|PDB:6R2W., /evidence=ECO:0007829|PDB:6R2W., /evidence=ECO:0007829|PDB:1UJ3., WKS motif., /evidence=ECO:0007829|PDB:6R2W., /evidence=ECO:0000269|PubMed:3166978., /evidence=ECO:0007829|PDB:6R2W., /evidence=ECO:0007829|PDB:6R2W., /evidence=ECO:0007829|PDB:2HFT., /evidence=ECO:0007829|PDB:8CN9., /evidence=ECO:0007829|PDB:6R2W., /evidence=ECO:0007829|PDB:1Z6J., /evidence=ECO:0007829|PDB:4YLQ., /evidence=ECO:0007829|PDB:6R2W., /evidence=ECO:0007829|PDB:6R2W., Interferon-alpha/beta receptor, fibronectin type III; pfam09294, /evidence=ECO:0007829|PDB:6R2W., I -> V (in dbSNP:rs3917627). /evidence=ECO:0000269|Ref.9. /id=VAR_014299., /evidence=ECO:0007829|PDB:6R2W., N-linked (GlcNAc...) asparagine. /evidence=ECO:0000255., /evidence=ECO:0007829|PDB:6R2W., R -> W (in dbSNP:rs5901). /id=VAR_012008., N-linked (GlcNAc...) asparagine. /evidence=ECO:0000255., /evidence=ECO:0007829|PDB:6R2W., /evidence=ECO:0007829|PDB:6R2W., /evidence=ECO:0007829|PDB:6R2W., /evidence=ECO:0007829|PDB:6R2W., WKS motif., /evidence=ECO:0007829|PDB:3TH2., /evidence=ECO:0007829|PDB:6R2W., TAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSP -> YSTSLELWYLWSSSLSSSWLYLYTSVERQEWGRAGRRTPH (in isoform 2). /evidence=ECO:0000303|PubMed:12652293. /id=VSP_041896., /evidence=ECO:0007829|PDB:1WV7., /evidence=ECO:0007829|PDB:6R2W., /evidence=ECO:0000269|PubMed:3166978., /evidence=ECO:0007829|PDB:6R2W., Missing (in isoform 2). /evidence=ECO:0000303|PubMed:12652293. /id=VSP_041897., /evidence=ECO:0007829|PDB:1BOY., Helical. /evidence=ECO:0000255., V -> A (in Ref. 1; AAA61151). /evidence=ECO:0000305., Cytoplasmic. /evidence=ECO:0000255., S-palmitoyl cysteine. /evidence=ECO:0000269|PubMed:3166978., /evidence=ECO:0007829|PDB:2CEF., G -> E (in dbSNP:rs3789683). /id=VAR_052280., /evidence=ECO:0007829|PDB:2CEF.
Endotoxin level < 10 EU/mg
Purity >95% as determined by SDS-PAGE.
Purification Protein A/G purified from cell culture supernatant.
Accession P13726
Form Liquid
Storage buffer 0.01M PBS pH 7.4

Please refer to the specific buffer information in the hardcopy of datasheet or the lot-specific COA.

Stability and Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Store at 4°C short term (1-2 weeks). Store at -20°C 12 months. Store at -80°C long term from the date of receipt..
Alternate NamesCAS: 3074785-85-3
Note For research use only.
Images
References
Formula
Mass (g) = Concentration (mol/L) × Volume (L) × MW (g/mol)
Enter any 2 of Mass, Concentration, Volume + Molecular Weight to solve for the unknown.
Mass
=
Concentration
×
Volume
Molecular Weight *
g/mol
Formula
C₁ × V₁ = C₂ × V₂
Enter any 3 of the 4 values to solve for the unknown.
Stock Solution
C₁ (Stock Conc.)
×
V₁ (Stock Vol.)
=
Working Solution
C₂ (Working Conc.)
×
V₂ (Working Vol.)
Recommendation

Contact us for custom quotes, bulk requests and any other issues.

Mail: [email protected]

Distributor list